Active Recombinant Canine IL4 Protein

• Cat.No.: IL4-177C
• Product Overview: Recombinant Canine IL4 Protein without tag was expressed in E. coli.

Specification

• Species: Canine
• Source: E.coli
• Description: Interleukin 4 (IL-4) is an immunomodulatory cytokine that functions to induce naƒ¯ve helper T cells to differentiate into type 2 T helper (Th2) cells, Th2 cells subsequently produce more IL-4 in a positive feedback loop, IL-4 also promotes immunoglobulin IgG to IgE isotype switching on B cells, IL-4 binds the IL-4RŽ± receptor to activate STAT6 signaling.
• Bio-activity: TF-1 cell proliferation, ED50≤25 ng/mL
• Molecular Mass: Monomer, 12.9 kDa (with 109 amino acids)
• AA Sequence: MHNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
• Endotoxin: ≤1 EUs/μg, Kinetic LAL (50% confidence)
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20‚ centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: IL4 interleukin 4 [ Canis lupus familiaris (dog) ]
• Official Symbol: IL4
• Synonyms: IL4; interleukin 4; interleukin-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; IL-4
• Gene ID: 403785
• mRNA Refseq: NM_001003159
• Protein Refseq: NP_001003159
• UniProt ID: O77762