Active Recombinant Bovine TNF Protein (80 aa)

• Cat.No.: TNF-307T
• Product Overview: Recombinant Bovine Tumor Necrosis Factor-alpha (rbTNF-α) produced in E. coli cells is a single non-glycosylated polypeptide chain containing 80 amino acids. A fully biologically active molecule, rbTNF-α has a molecular mass of 17.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Bovine
• Source: E.coli
• Protein Length: 80
• Description: Tumor Necrosis Factor-Alpha (TNF-α) plays a major role in regulating growth, differentiation, inflammation, viral replication, tumorigenesis, and autoimmune diseases. TNF alpha-1a is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells. In addition to inducing hemorrhagic necrosis of tumors, studies indicate TNF is involved in tumor igenesis, tumor metastasis, viral replication, septic shock, fever, inflammation, Crohn's disease, rheumatoid arthritis and graft-versus-host disease.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.1 μg/mL, measured in a cytotoxicity assay using mouse L-929 cells in the presence of actinomycin D, corresponding to a specific activity of > 1 × 10^4 units/mg.
• Molecular Mass: 17.6 kDa, observed by reducing SDS-PAGE
• AA Sequence: MLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE & HPLC
• Storage: Lyophilized recombinant Bovine TNF-α remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Bovine TNF-α should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: TNF tumor necrosis factor [ Bos taurus (cattle) ]
• Official Symbol: TNF
• Synonyms: TNF; tumor necrosis factor; TNFa; TNF-a; TNF-alpha; tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor ligand superfamily member 2
• Gene ID: 280943
• mRNA Refseq: NM_173966
• Protein Refseq: NP_776391
• UniProt ID: P59684