Active GMP Recombinant Porcine TNF-α Protein, His-Tagged

• Cat.No.: TNF-α-01P
• Product Overview: GMP Recombinant Porcine TNF-α Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: TNF-α is a kind of pleiotropic pro-inflammatory cytokine. It is secreted by various cells, such as adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. Proteolysis of the integral membrane precursor form of TNF-α from cells soluble can release homotrimeric TNF-α. TNF-α can bind with some TNF-α receptors induces apoptosis, besides, also trigger other responses depending on cell type, receptor expression, and signal transduction status. TNF-α participate in the inflammatory response.
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is <15 pg/mL.
• AA Sequence: MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.