Active GMP Recombinant Porcine IL15 Protein, His-Tagged

• Cat.No.: IL15-01P
• Product Overview: GMP Recombinant Porcine IL15 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells.
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <5.5 ng/mL.
• AA Sequence: TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >95% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: IL15 interleukin 15 [ Sus scrofa (pig) ]
• Official Symbol: IL15
• Synonyms: IL-15
• Gene ID: 397683
• mRNA Refseq: NM_214390.1
• Protein Refseq: NP_999555.1
• UniProt ID: Q95253