Active GMP Recombinant Porcine IL15 Protein, His-Tagged
Cat.No. : | IL15-01P |
Product Overview : | GMP Recombinant Porcine IL15 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <5.5 ng/mL. |
AA Sequence : | TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | IL15 interleukin 15 [ Sus scrofa (pig) ] |
Official Symbol | IL15 |
Synonyms | IL-15 |
Gene ID | 397683 |
mRNA Refseq | NM_214390.1 |
Protein Refseq | NP_999555.1 |
UniProt ID | Q95253 |
◆ Recombinant Proteins | ||
IL15-2291G | Recombinant Goat IL15 Protein, His-tagged | +Inquiry |
IL15-2474H | Recombinant Human IL15 Protein (Asn49-Ser162), C-His tagged | +Inquiry |
IL15-20C | Recombinant Chicken IL-15 | +Inquiry |
IL15-125H | Recombinant Human IL15 protein | +Inquiry |
IL15-263S | Recombinant Swine IL15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *
0
Inquiry Basket