Active GMP Recombinant Porcine CXCL10 Protein, His-Tagged

• Cat.No.: CXCL10-01P
• Product Overview: GMP Recombinant Porcine CXCL10 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: CXCL10 ,belongs to the CXC chemokine family, is also known as IP-10. CXCL10 was originally identified as a responsor to IFN-gamma in monocytes, endothelial cells and fibroblasts. The effects of this chemokine can be induced by binding to the cell surface chemokine receptor CXCR3. Research shows that CXCL10 is a chemoattractant for activated T-lymphocytes, monocytes and macrophages. It also has other functions, such as promotion of T cell adhesion to endothelial cell.
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <4 ng/mL.
• AA Sequence: PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: CXCL10 C-X-C motif chemokine ligand 10 [ Sus scrofa (pig) ]
• Official Symbol: CXCL10
• Gene ID: 494019
• mRNA Refseq: NM_001008691.1
• Protein Refseq: NP_001008691.1
• UniProt ID: A0A4X1SX64