| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Enables transmembrane receptor protein tyrosine kinase activator activity. Involved in positive regulation of DNA binding activity; positive regulation of Ras protein signal transduction; and positive regulation of protein phosphorylation. Acts upstream of or within several processes, including cell surface receptor signaling pathway; positive regulation of cell projection organization; and positive regulation of macromolecule metabolic process. Located in neuron projection terminus. Is expressed in several structures, including alimentary system; genitourinary system; limb; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including IgA glomerulonephritis; end stage renal disease; hereditary sensory and autonomic neuropathy type 5; interstitial cystitis; and neurogenic bladder. Orthologous to human NGF (nerve growth factor). |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 10^6 IU/mg. |
| AA Sequence : |
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
