Active GMP Recombinant Mouse Ngf Protein, His-Tagged
Cat.No. : | Ngf-01M |
Product Overview : | GMP Recombinant Mouse Ngf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables transmembrane receptor protein tyrosine kinase activator activity. Involved in positive regulation of DNA binding activity; positive regulation of Ras protein signal transduction; and positive regulation of protein phosphorylation. Acts upstream of or within several processes, including cell surface receptor signaling pathway; positive regulation of cell projection organization; and positive regulation of macromolecule metabolic process. Located in neuron projection terminus. Is expressed in several structures, including alimentary system; genitourinary system; limb; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including IgA glomerulonephritis; end stage renal disease; hereditary sensory and autonomic neuropathy type 5; interstitial cystitis; and neurogenic bladder. Orthologous to human NGF (nerve growth factor). |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 10^6 IU/mg. |
AA Sequence : | MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Ngf nerve growth factor [ Mus musculus (house mouse) ] |
Official Symbol | Ngf |
Synonyms | Ngfb; beta-NGF |
Gene ID | 18049 |
mRNA Refseq | NM_001112698.2 |
Protein Refseq | NP_001106168.1 |
UniProt ID | P01139 |
◆ Native Proteins | ||
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ngf Products
Required fields are marked with *
My Review for All Ngf Products
Required fields are marked with *
0
Inquiry Basket