Active GMP Recombinant Mouse Ngf Protein, His-Tagged

• Cat.No.: Ngf-01M
• Product Overview: GMP Recombinant Mouse Ngf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Description: Enables transmembrane receptor protein tyrosine kinase activator activity. Involved in positive regulation of DNA binding activity; positive regulation of Ras protein signal transduction; and positive regulation of protein phosphorylation. Acts upstream of or within several processes, including cell surface receptor signaling pathway; positive regulation of cell projection organization; and positive regulation of macromolecule metabolic process. Located in neuron projection terminus. Is expressed in several structures, including alimentary system; genitourinary system; limb; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including IgA glomerulonephritis; end stage renal disease; hereditary sensory and autonomic neuropathy type 5; interstitial cystitis; and neurogenic bladder. Orthologous to human NGF (nerve growth factor).
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 10^6 IU/mg.
• AA Sequence: MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Ngf nerve growth factor [ Mus musculus (house mouse) ]
• Official Symbol: Ngf
• Synonyms: Ngfb; beta-NGF
• Gene ID: 18049
• mRNA Refseq: NM_001112698.2
• Protein Refseq: NP_001106168.1
• UniProt ID: P01139