Active GMP Recombinant Mouse Cxcl9 Protein, His-Tagged

• Cat.No.: Cxcl9-01M
• Product Overview: GMP Recombinant Mouse Cxcl9 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Predicted to enable CXCR3 chemokine receptor binding activity and chemokine activity. Acts upstream of or within several processes, including defense response to virus; positive regulation of myoblast differentiation; and positive regulation of myoblast fusion. Located in external side of plasma membrane and extracellular space. Is expressed in central nervous system; retina; stomach; testis; and thymus. Orthologous to human CXCL9 (C-X-C motif chemokine ligand 9).
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED50 for this effect is <0.3 μg/mL.
• AA Sequence: TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKP
  KTPQSRRRSRKTT with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl9 chemokine (C-X-C motif) ligand 9 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl9
• Synonyms: CMK; Mig; MuMIG; Scyb9; crg-10
• Gene ID: 17329
• mRNA Refseq: NM_008599.4
• Protein Refseq: NP_032625.2
• UniProt ID: P18340