Active GMP Recombinant Mouse Csf2 Protein, His-Tagged

• Cat.No.: Csf2-01M
• Product Overview: GMP Recombinant Mouse Csf2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Enables cytokine activity. Acts upstream of or within several processes, including embryonic placenta development; myeloid leukocyte differentiation; and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including genitourinary system; hemolymphoid system; labyrinthine zone; liver; and lung. Used to study pulmonary alveolar proteinosis. Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2)
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce proliferation in FDC-P1 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2x 10^7 IU/mg.
• AA Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCE
  TQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ]
• Official Symbol: Csf2
• Synonyms: CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM
• Gene ID: 12981
• mRNA Refseq: NM_009969.4
• Protein Refseq: NP_034099.2
• UniProt ID: P01587