Active GMP Recombinant Human IL7 protein

• Cat.No.: IL8-4323HG
• Product Overview: Recombinant Human IL7 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Interleukin-8 (IL-8) is encoded by the IL8 gene andproduced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. IL-8 (72a.a.) has a 5-10-fold higher activity on neutrophil activation, compared to IL-8 (77a.a.). IL-8 is often associated with inflammation and has been cited as a proinflammatory mediator in gingivitis and psoriasis.
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10^5 IU/mg.
• Molecular Mass: Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids.
• AA Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
• Endotoxin: Less than 1 EU/µg of rHuIL-8, 72a.a./CXCL8 as determined by LAL method.
• Purity: > 97 % by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: CXCL8 chemokine (C-X-C motif) ligand 8 [ Homo sapiens ]
• Official Symbol: IL8
• Synonyms: IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; 4q13-q21; interleukin-8; emoctakin; interleukin 8; T-cell chemotactic factor; neutrophil-activating peptide 1; beta-thromboglobulin-like protein; granulocyte chemotactic protein 1; tumor necrosis factor-induced gene 1; alveolar macrophage chemotactic factor I; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lymphocyte derived neutrophil activating peptide; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide
• Gene ID: 3576
• mRNA Refseq: NM_000584
• Protein Refseq: NP_000575
• MIM: 146930
• UniProt ID: P10145