Active GMP Recombinant Human IL12 Protein
Cat.No. : | IL12-158HG |
Product Overview : | Recombinant Human IL12 (Arg23-Ser219&Ile23-Ser328) was produced in HEK293 cell in an animal component free process under cGMP guidelines. |
Availability | April 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Protein Length : | 23-219;23-328 a.a. |
Description : | IL-12 is a heterodimeric pleiotropic cytokine made up of a 40 kDa (p40) subunit and a 35 kDa (p35) subunit.Human and mouse IL‑12 share 70% and 60% amino acid sequence identity in their p40 and p35 subunits, respectively. IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-γ) and tumor necrosis factor-alpha (TNF-α) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-γ. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity.IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes. |
Form : | Lyophilized. |
Bio-activity : | Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is typically 0.5 ng/ml. |
AA Sequence : | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Residual Host Cell DNA Content : | <10pg/mg |
Residual Host Cell Protein Content : | <1ug/mg |
Endotoxin : | <0.1EU/ug |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Usage : | Recommemnd working concentration: 0.5ng/ml |
Storage : | Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ] IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens |
Synonyms | IL-12A; NFSK; P35; IL-12 subunit p35; IL-12, subunit p35; IL12A; IL12B; NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; p40; IL 12B; IL12; subunit p40; interleukin 12; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin |
Gene ID | 3592; 3593 |
mRNA Refseq | NM_000882; NM_002187 |
Protein Refseq | NP_000873; NP_002178 |
MIM | 161560; 161561 |
UniProt ID | P29459; P29460 |
◆ Recombinant Proteins | ||
IL12B&IL12A-004H | Active Recombinant Human IL12B&IL12A, HIgG1 Fc-tagged | +Inquiry |
IL12-002H | Active Recombinant Human IL12, HIgG1 Fc-tagged, mutant | +Inquiry |
IL12-159HB | Recombinant Human IL12 protein, His-tagged, Biotinylated | +Inquiry |
IL12-26R | Recombinant Rat IL12 protein, His-tagged | +Inquiry |
Il12-258I | Active Recombinant Rat Il12 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *
0
Inquiry Basket