Active Recombinant Human IFNL1 Protein

• Cat.No.: IFNL1-945H
• Product Overview: Recombinant Human IFNL1 was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: Determined by its ability to activate STAT phosphorylation in an ISRE Luciferase Reporter Assay using human colon carcinoma COLO205 cells. The expected ED50 is 0.2-0.5 ng/ml.
• Molecular Mass: 19.8 kDa
• AA Sequence: PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPES
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: IFNL1 interferon lambda 1 [ Homo sapiens (human) ]
• Official Symbol: IFNL1
• Synonyms: L29; IL-29
• Gene ID: 282618
• mRNA Refseq: NM_172140
• Protein Refseq: NP_742152
• MIM: 607403
• UniProt ID: Q8IU54