| Cat.No.: | PE-1519 |
| Product Name: | Recombinant Human JARID2 |
| Product Overview: | Recombinant fragment corresponding to amino acids 1130-1229 of Human Jarid2 with a proprietary tag at N-terminal predicted MWt 37 kDa |
| Description: | This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a DNA-binding domain, called an AT-rich interaction domain (ARID), and share regions of similarity with human retinoblastoma-binding protein-2 and the human SMCX protein. |
| Tissue Specificity: | During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37.000kDa |
| Species: | Human |
| Amino Acid Sequence: | LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP |
| Sequence Similarities: | Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | JARID2 jumonji, AT rich interactive domain 2 [ Homo sapiens ] |
| Gene ID NCBI: | 3720 |
| Official Symbol: | JARID2 |
| Synonyms: | JARID2; jumonji, AT rich interactive domain 2; JMJ, jumonji (mouse) homolog , Jumonji, AT rich interactive domain 2; protein Jumonji; |
| mRNA Refseq: | NM_004973 |
| Protein Refseq: | NP_004964 |
| MIM: | 601594 |
| UniProt ID: | Q92833 |
| Chromosome Location: | 6p24-p23 |
| Function: | DNA binding; chromatin binding; NOT histone demethylase activity; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0002 | AT9283 | Inquiry |
| ◆ Cell Lines | ||
| CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
| CL-0081 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0079 | JARID2 Polyclonal Antibody | Inquiry |
| EAb-0080 | JARID1C Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| JADE1 | JAK | JAK1 | JAK2 |
| JAK3 | JAKMIP1 | JARID | JARID1 |
| JARID1A | JARID1B | JARID1C | JARID2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
