Recombinant Human ARID5B protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1501
Product Name:  Recombinant Human ARID5B protein, GST-tagged
Product Overview:  Human ARID5B partial ORF (XP_084482, 1483 a.a. - 1582 a.a.) recombinant protein with GST-tag at N-terminal.
Description:  This gene encodes a member of the AT-rich interaction domain (ARID) family of DNA binding proteins. The encoded protein forms a histone H3K9Me2 demethylase complex with PHD finger protein 2 and regulates the transcription of target genes involved in adipogenesis and liver development. This gene also plays a role in cell growth and differentiation of B-lymphocyte progenitors, and single nucleotide polymorphisms in this gene are associated with acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
Applications:  Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  36.74 kDa
Species:  Human
Tag:  GST
Amino Acid Sequence:  SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ARID5B AT rich interactive domain 5B (MRF1-like) [ Homo sapiens ]
Gene ID NCBI:  84159
Official Symbol:  ARID5B
Synonyms:  ARID5B; AT rich interactive domain 5B (MRF1-like); AT-rich interactive domain-containing protein 5B; FLJ21150; MRF2; MRF1-like protein; ARID domain-containing protein 5B; modulator recognition factor 2 (MRF2); DESRT; MRF-2; FLJ41888;
mRNA Refseq:  NM_001244638
Protein Refseq:  NP_001231567
MIM:  608538
UniProt ID:  Q14865

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.