| Cat.No.: | PE-1474 |
| Product Name: | Recombinant Human MSH6, GST-tagged |
| Product Overview: | Recombinant Human MSH6(931 a.a. - 1030 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
| Description: | This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described. |
| Applications: | ELISA; WB-Re; AP; Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 36.74 kDa |
| Species: | Human |
| Tag: | GST |
| Amino Acid Sequence: | AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKR YWTKTIEKKLANLINAEERRDVSLK |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MSH6 mutS homolog 6 [ Homo sapiens (human) ] |
| Gene ID NCBI: | 2956 |
| Synonyms: | MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5; mutS homolog 6; DNA mismatch repair protein Msh6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein |
| mRNA Refseq: | NM_000179 |
| Protein Refseq: | NP_000170 |
| MIM: | 600678 |
| Chromosome Location: | 2p16 |
| Function: | contributes_to ADP binding; contributes_to ATPase activity; contributes_to MutLalpha complex binding |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0104 | Recombinant Human MSL1 Lysate | Inquiry |
| EL-0193 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
| EL-0194 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
| EL-0218 | Recombinant Human MSH6 293 Cell Lysate | Inquiry |
| EL-0227 | Recombinant Human MSL2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MS4A7 | MSH2 | MSH3 | MSH5 |
| MSH6 | MSI2 | MSL1 | MSL2 |
| MSL3 | MSP58 | MST1 | MSY2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
