| Cat.No.: | PE-1413 |
| Product Name: | Recombinant Human H3F3B Protein, GST-tagged |
| Product Overview: | Recombinant Human H3F3B protein (3-136 aa) was expressed in E. coli with GST tag. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | 85 % |
| Species: | Human |
| Formulation: | Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
| Tag: | GST |
| Amino Acid Sequence: | RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Reconstitution: | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | H3F3B H3 histone, family 3B (H3.3B) [ Homo sapiens ] |
| Gene ID NCBI: | 3021 |
| Official Symbol: | H3F3B |
| Synonyms: | H3F3B; H3 histone, family 3B (H3.3B); histone H3.3; H3.3B; H3 histone, family 3A; H3F3A; |
| mRNA Refseq: | NM_005324 |
| Protein Refseq: | NP_005315 |
| MIM: | 601058 |
| UniProt ID: | P84243 |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
