Recombinant Human MTA1, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1376
Product Name:  Recombinant Human MTA1, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 105-452 of Human MTA1 with N terminal His tag; 348 amino acids, 40kDa.
Description:  This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. Two transcript variants encoding different isoforms have been found for this gene.
Tissue Specificity:  Widely expressed. High expression in brain, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 96 μl aqua dest.
Tag:  His
Amino Acid Sequence:  HRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLERE DFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLK EGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGT FARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHK NIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEE ALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQ QKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGV VNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQC RLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHG
Sequence Similarities:  Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  MTA1 metastasis associated 1 [ Homo sapiens ]
Gene ID NCBI:  9112
Official Symbol:  MTA1
Synonyms:  MTA1; metastasis associated 1; metastasis-associated protein MTA1;
mRNA Refseq:  NM_001203258
Protein Refseq:  NP_001190187
MIM:  603526
UniProt ID:  Q13330
Chromosome Location:  14q32.33
Function:  metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;
Product Types
◆ Bioactive Small Molecules
BSM-0065 5’-Deoxy-5’-methylthioadenosine Inquiry
◆ Extracts & Lysates
EL-0165 Recombinant Human MTF1 293 Cell Lysate Inquiry
EL-0195 Recombinant Human MTA1 293 Cell Lysate Inquiry
◆ Antibodies
EAb-0325 MTF2 Polyclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-0435 Recombinant Human MTA2, GST-tagged Inquiry
Related Gene / Proteins
MTA MTA1 MTA2 MTA3
MTF1 MTF2 MTR

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.