| Cat.No.: | PE-1342 |
| Product Name: | Recombinant Human SETD3, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 443-594 of Human SETD3 With N terminal His tag; 152 amino acids, 40 kDa. |
| Description: | SETD3 contains 1 SET domain. The function of the SETD3 protein remains unknown. There are 3 isoforms produced by alternative splicing. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitution with 64 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | TTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSA AVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLP LVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENS IPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SETD3 SET domain containing 3 [ Homo sapiens ] |
| Gene ID NCBI: | 84193 |
| Official Symbol: | SETD3 |
| Synonyms: | SETD3; SET domain containing 3; C14orf154, chromosome 14 open reading frame 154; histone-lysine N-methyltransferase setd3; FLJ23027; |
| mRNA Refseq: | NM_032233 |
| Protein Refseq: | NP_115609 |
| UniProt ID: | Q86TU7 |
| Chromosome Location: | 14q32.2 |
| Function: | histone methyltransferase activity (H3-K36 specific); methyltransferase activity; transcription coactivator activity; transferase activity; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| EAb-0033 | Setd1b Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 More > |
| SETMAR | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
