| Cat.No.: | PE-1337 |
| Product Name: | Recombinant Human TADA3, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 87-432 of Human TADA3L with N terminal His tag. Predicted MWt 40 kDa; |
| Description: | Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 54 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | GRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNL QPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCAD ITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQ EDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDAL LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPME DSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLES RIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELK ALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVM DAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLL DG |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | TADA3 transcriptional adaptor 3 [ Homo sapiens ] |
| Gene ID NCBI: | 10474 |
| Official Symbol: | TADA3 |
| Synonyms: | TADA3; transcriptional adaptor 3; TADA3L, transcriptional adaptor 3 (NGG1 homolog, yeast) like; transcriptional adapter 3; ADA3; FLJ20221; FLJ21329; hADA3; NGG1; |
| mRNA Refseq: | NM_006354 |
| Protein Refseq: | NP_006345 |
| MIM: | 602945 |
| UniProt ID: | O75528 |
| Chromosome Location: | 3p25.3 |
| Function: | contributes_to histone acetyltransferase activity; ligand-dependent nuclear receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein domain specific binding; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0017 | TAF1 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0056 | Recombinant Human TAL1 293 Cell Lysate | Inquiry |
| EL-0108 | Recombinant Human TAF7 293 Cell Lysate | Inquiry |
| EL-0178 | Recombinant Human TADA1 Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0121 | Human TAP2 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| TADA1 | TADA1L | TADA2A | TADA2B |
| TADA3 | TAE1 | TAF-I | taf1 |
| TAF1L | TAF6L | TAF7 | TAF7L |
| TAL1 | TAP2 | TAZ | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
