| Cat.No.: | PE-1281 |
| Product Name: | Recombinant Human CBX5, His-tagged |
| Product Overview: | Recombinant full length protein, corresponding to amino acids 1-191 of Human HP1 alpha with N terminal His tag, Predicted MWt 23 kDa. |
| Description: | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 163 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLK WKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGEN NKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARG FERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAK EANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
| Sequence Similarities: | Contains 2 chromo domains. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | CBX5 chromobox homolog 5 [ Homo sapiens ] |
| Gene ID NCBI: | 23468 |
| Official Symbol: | CBX5 |
| Synonyms: | CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; |
| mRNA Refseq: | NM_001127321 |
| Protein Refseq: | NP_001120793 |
| MIM: | 604478 |
| UniProt ID: | P45973 |
| Chromosome Location: | 12q13.13 |
| Function: | chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding; |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0053 | Human CBX5 Knockout Cell Line 2bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0146 | CBX5 Polyclonal Antibody | Inquiry |
| EAb-0148 | CBX3 Polyclonal Antibody | Inquiry |
| EAb-0150 | CBX2 Polyclonal Antibody | Inquiry |
| EAb-0153 | CBFb Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CBFb | CBX2 | CBX3 | CBX4 |
| CBX5 | CBX6 | CBX7 | CBX8 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
