| Cat.No.: | PE-1175 |
| Product Name: | Recombinant Human PHF1 |
| Product Overview: | Recombinant fragment of Human PHF1 with N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag. |
| Description: | This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Tissue Specificity: | Highest levels in heart, skeletal muscle, and pancreas, lower levels in brain, placenta, lung, liver and kidney. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.520kDa inclusive of tags |
| Species: | Human |
| Tag: | His |
| Amino Acid Sequence: | AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP |
| Sequence Similarities: | Contains 2 PHD-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | 99 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | PHF1 PHD finger protein 1 [ Homo sapiens ] |
| Gene ID NCBI: | 5252 |
| Official Symbol: | PHF1 |
| Synonyms: | PHF1; PHD finger protein 1; MTF2L2; |
| mRNA Refseq: | NM_002636 |
| Protein Refseq: | NP_002627 |
| MIM: | 602881 |
| UniProt ID: | O43189 |
| Chromosome Location: | 6p21.3 |
| Function: | metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0056 | PHF8 Polyclonal Antibody | Inquiry |
| EAb-0058 | PHC2 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0114 | DMOG | Inquiry |
| ◆ Cell Lines | ||
| CL-0115 | Human PHF6 Knockout Cell Line 1bp deletion | Inquiry |
| CL-0116 | Human PHIP Knockout Cell Line 2bp deletion | Inquiry |
| Related Gene / Proteins | |||
| PHB | PHC1 | PHC2 | PHD |
| PHD1 | PHD2 | PHD3 | PHF1 |
| PHF10 | PHF13 | PHF17 | PHF2 |
| PHF20 | PHF20B | PHF21A | PHF21B |
| PHF6 | PHF8 | PHIP | PHPT1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
