| Cat.No.: | PE-0995 |
| Product Name: | Recombinant Human EHMT1, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 460-716 of Human KMT1D / GLP / Eu HMTase1 with N terminal His tag; 257 amino acids, 38kDa. |
| Description: | The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 103 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | SQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMR CWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRV VQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSR FINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAG EQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQA SAAQEAQEDGLPDTSSAAAADPL |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | EHMT1 euchromatic histone-lysine N-methyltransferase 1 [ Homo sapiens ] |
| Gene ID NCBI: | 79813 |
| Official Symbol: | EHMT1 |
| Synonyms: | EHMT1; euchromatic histone-lysine N-methyltransferase 1; euchromatic histone methyltransferase 1; histone-lysine N-methyltransferase EHMT1; bA188C12.1; Eu HMTase1; FLJ12879; KIAA1876; KMT1D; |
| mRNA Refseq: | NM_024757 |
| Protein Refseq: | NP_079033 |
| MIM: | 607001 |
| UniProt ID: | Q9H9B1 |
| Chromosome Location: | 9 |
| Function: | histone methyltransferase activity (H3-K27 specific); histone methyltransferase activity (H3-K9 specific); histone-lysine N-methyltransferase activity; metal ion binding; methyltransferase activity; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0025 | BIX01294 (hydrochloride hydrate) | Inquiry |
| BSM-0026 | UNC0224 | Inquiry |
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Cell Lines | ||
| CL-0059 | Human EHMT1 Knockout Cell Line 7bp deletion | Inquiry |
| CL-0060 | Human EHMT2 Knockout Cell Line 34bp deletion | Inquiry |
| Related Gene / Proteins | |||
| EHD2 | EHMT1 | EHMT2 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
