| Cat.No.: | PE-0811 |
| Product Name: | Recombinant Human ETS1 Protein, His-tagged |
| Product Overview: | Recombinant Human ETS1, transcript variant 2, fused with His tag at N-terminal was expressed in E. coli. |
| Description: | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 33kD |
| Purity: | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Species: | Human |
| Formulation: | Lyophilized from a 0.2 µM filtered solution of PBS, 1mM EDTA, pH 7.4 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDN |
| Endotoxin: | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ETS1 v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) [ Homo sapiens ] |
| Gene ID NCBI: | 2113 |
| Official Symbol: | ETS1 |
| Synonyms: | ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; p54; v-ets avian erythroblastosis virus E2 oncogene homolog 1; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ETS-1; EWSR2; |
| mRNA Refseq: | NM_001143820 |
| Protein Refseq: | NP_001137292 |
| MIM: | 164720 |
| UniProt ID: | P14921 |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0105 | Recombinant Human ETS1 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0139 | ETO Polyclonal Antibody | Inquiry |
| EAb-0195 | ERM/ ETV5 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0804 | Recombinant Human ETS1 | Inquiry |
| PE-0805 | Recombinant Human ETS1 | Inquiry |
| Related Gene / Proteins | |||
| ETO | ETR3 | ETS1 | ETV5 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
