Recombinant Human RUNX2


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0747
Product Name:  Recombinant Human RUNX2
Product Overview:  Recombinant fragment corresponding to amino acids 251-350 of Human RUNX2 with a proprietary tag at N-terminal; predicted MWT 36.63kDa inclusive of tag.
Description:  This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
Tissue Specificity:  Specifically expressed in osteoblasts.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36.630kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Sequence Similarities:  Contains 1 Runt domain.
Expression System:  Wheat germ
Protein Length:  100 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  RUNX2 runt-related transcription factor 2 [ Homo sapiens ]
Gene ID NCBI:  860
Official Symbol:  RUNX2
Synonyms:  RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1;
mRNA Refseq:  NM_001015051
Protein Refseq:  NP_001015051
MIM:  600211
UniProt ID:  Q13950
Chromosome Location:  6p21
Function:  ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity;
Product Types
◆ Antibodies
EAb-0042 Runx1/AML1-ETO Polyclonal Antibody Inquiry
EAb-0313 RUNX2 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0092 Recombinant Human RUNX2 293 Cell Lysate Inquiry
EL-0093 Recombinant Human RUNX2 293 Cell Lysate Inquiry
◆ Proteins & Enzymes
PE-0746 Recombinant Human RUNX2 Inquiry
Related Gene / Proteins
Runx1 RUNX2 RUVB2 RUVBL1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.