| Cat.No.: | PE-0712 |
| Product Name: | Recombinant Human BCOR Protein, GST-tagged |
| Product Overview: | Human BCOR partial ORF ( NP_060215, 1361 a.a. - 1460 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | The protein encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 36.74 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | BCOR BCL6 corepressor [ Homo sapiens ] |
| Gene ID NCBI: | 54880 |
| Official Symbol: | BCOR |
| Synonyms: | BCOR; BCL6 corepressor; BCL6 co repressor; BCL-6 corepressor; FLJ20285; KIAA1575; BCL6 co-repressor; BCL-6 interacting corepressor; MAA2; ANOP2; MCOPS2; FLJ38041; MGC71031; MGC131961; |
| mRNA Refseq: | NM_001123383 |
| Protein Refseq: | NP_001116855 |
| MIM: | 300485 |
| UniProt ID: | Q6W2J9 |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0087 | Recombinant Human BCOR 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0708 | Recombinant Human BCOR, GST-tagged | Inquiry |
| PE-0709 | Recombinant Zebrafish BCOR | Inquiry |
| PE-0710 | Recombinant Mouse BCOR Protein | Inquiry |
| PE-0711 | Recombinant Human BCOR Protein, GST-tagged | Inquiry |
| Related Gene / Proteins | |||
| Bcl10 | BCL11A | Bcl3 | Bcl6 |
| BCOR | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
