| Cat.No.: | PE-0630 |
| Product Name: | Recombinant Human NR2E1 protein, T7/His-tagged |
| Product Overview: | Recombinant human NR2E1 cDNA (384aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Formulation: | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRN RTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPS AALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSI KWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVV ARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLL PALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | NR2E1 nuclear receptor subfamily 2, group E, member 1 [ Homo sapiens ] |
| Gene ID NCBI: | 7101 |
| Official Symbol: | NR2E1 |
| Synonyms: | NR2E1; nuclear receptor subfamily 2, group E, member 1; TLX; nuclear receptor subfamily 2 group E member 1; TLL; XTLL; hTll; tailless homolog; nuclear receptor TLX; tailes-related receptor; protein tailless homolog; |
| mRNA Refseq: | NM_003269 |
| Protein Refseq: | NP_003260 |
| MIM: | 603849 |
| UniProt ID: | Q9Y466 |
| Chromosome Location: | 6q21 |
| Function: | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0076 | Recombinant Human NR2E1 Cell Lysate | Inquiry |
| EL-0130 | Recombinant Human NRIP1 293 Cell Lysate | Inquiry |
| EL-0166 | Recombinant Human NR4A3 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0400 | Iberin | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0626 | Recombinant Chicken NR2E1 | Inquiry |
| Related Gene / Proteins | |||
| NR0B1 | NR2C2 | NR2E1 | NR2F2 |
| NR3C1 | NR4A3 | NRF1 | Nrf2 |
| NRIP1 | NRMT1 | NRU | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
