| Cat.No.: | PE-0524 |
| Product Name: | Recombinant Human CCND1 protein, T7/His-tagged |
| Product Overview: | Recombinant human cDNA (294aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE. |
| Species: | Human |
| Formulation: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGEFEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCV QKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEK LCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISN PPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEE EEEEEEEVDLACTPTDVRDVDI |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) [ Homo sapiens ] |
| Gene ID NCBI: | 893 |
| Official Symbol: | CCND1 |
| Synonyms: | CCND1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; BCL-1; PRAD1; D11S287E; |
| MIM: | 168461 |
| UniProt ID: | P24385 |
| Chromosome Location: | 11q13 |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0060 | Recombinant Human CCND1 293 Cell Lysate | Inquiry |
| EL-0120 | Recombinant Human CCNB1 Cell Lysate | Inquiry |
| EL-0197 | Recombinant Human CCDC101 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0515 | Recombinant Human Cyclin D1, GST-tagged | Inquiry |
| PE-0516 | Recombinant Human CCND1, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| CCDC101 | CCL14 | CCNB1 | CCND1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
