| Cat.No.: | PE-0443 |
| Product Name: | Recombinant Human ACTL6A protein, T7-tagged |
| Product Overview: | Recombinant human ACTL6A protein fused with 15aa (T7) at N-terminal, was expressed in E. coli. |
| Applications: | 1. Protein transduction for studying SWI/SNF-like BAF complex in vitro.2. Active recombinant protein, may be used for ELISA based DNA / protein binding assay.3. As specific protein substrate for kinase assay.4. As immunogen for specific antibody production. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Formulation: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Tag: | T7 |
| Amino Acid Sequence: | MASMTGGQENGRGEFSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKG KQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKL TELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQ EMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVH YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFT DRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ACTL6A actin-like 6A [ Homo sapiens ] |
| Gene ID NCBI: | 86 |
| Official Symbol: | ACTL6A |
| Synonyms: | ACTL6A; actin-like 6A; actin-like protein 6A; actin related protein 4; Actl6; Arp4; BAF complex 53 kDa subunit; BAF53A; Baf53a; BRG1 associated factor; ACTL6; ARPN-BETA; |
| mRNA Refseq: | NM_004301 |
| Protein Refseq: | NP_004292 |
| MIM: | 604958 |
| UniProt ID: | O96019 |
| Chromosome Location: | 3q26.33 |
| Function: | ATP binding; chromatin binding; protein binding; transcription coactivator activity; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0035 | Arecoline hydrobromide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0045 | Recombinant Human ACTL6A 293 Cell Lysate | Inquiry |
| EL-0046 | Recombinant Human ACTL6A 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0193 | Human ACRBP Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-0201 | BAF53B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| ACAT1 | ACRBP | ACTL6 | ACTR8 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
