| Cat.No.: | PE-0416 |
| Product Name: | Recombinant Human UHRF1 |
| Product Overview: | Recombinant fragment corresponding to aa 694-793 of human UHRF1 with a proprietary tag; 36.63kDa inclusive of tag. |
| Description: | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Applications: | This product is useful for Antibody Production and Protein Array |
| Tissue Specificity: | Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.630kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
| Sequence Similarities: | Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | UHRF1 ubiquitin-like with PHD and ring finger domains 1 [ Homo sapiens ] |
| Gene ID NCBI: | 29128 |
| Official Symbol: | UHRF1 |
| Synonyms: | UHRF1; ubiquitin-like with PHD and ring finger domains 1; E3 ubiquitin-protein ligase UHRF1; FLJ21925; ICBP90; Np95; RNF106; |
| mRNA Refseq: | NM_001048201 |
| Protein Refseq: | NP_001041666 |
| MIM: | 607990 |
| UniProt ID: | Q96T88 |
| Chromosome Location: | 19p13.3 |
| Function: | DNA binding; core promoter proximal region sequence-specific DNA binding; ligase activity; metal ion binding; methyl-CpG binding; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0011 | UHRF2 Polyclonal Antibody | Inquiry |
| EAb-0012 | UHRF1 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0044 | Recombinant Human UHRF1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0416 | Recombinant Human UHRF1 | Inquiry |
| PE-0417 | Recombinant Zebrafish UHRF1 | Inquiry |
| Related Gene / Proteins | |||
| UHRF1 | UHRF2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
