| Cat.No.: | PE-0348 |
| Product Name: | Recombinant Human BRD7, GST-tagged |
| Product Overview: | Recombinant Human BRD7 full-length ORF (1 a.a. - 651 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
| Description: | This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants. |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 97.13 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPG EEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRK DPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLL HSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPIVGEPGYCPVRLGMTT GRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFANISKDDSDLIYSTYGEDSDLPSDFSIHEFLA TCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVT NFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | BRD7 bromodomain containing 7 [ Homo sapiens ] |
| Gene ID NCBI: | 29117 |
| Synonyms: | BP75; NAG4; CELTIX1; bromodomain-containing protein 7; 75 kDa bromodomain protein; protein CELTIX-1 |
| mRNA Refseq: | NM_001173984 |
| Protein Refseq: | NP_001167455 |
| Chromosome Location: | 16q12 |
| Function: | histone binding; lysine-acetylated histone binding; p53 binding |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
| SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
| SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
| SP-0004 | Bromodomain Ligand 3 | Inquiry |
| SP-0006 | Bromodomain Ligand 4 | Inquiry |
| Related Gene / Proteins | |||
| BRCA1 | BRCA2 | BRCC3 | BRD |
| brd1 | brd2 | brd3 | brd4 |
| BRD7 | BRD8 | brd9 | brdt |
| BRL | BRM | BRMS1 | BRPF1 |
| BRPF2 | brpf3 | BRWD1 | BRWD3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
