| Cat.No.: | PE-0281 |
| Product Name: | Recombinant Human DNMT3L |
| Product Overview: | Recombinant fragment corresponding to aa 288-387 of human Dnmt3L with a proprietary tag; 36.63kDa inclusive of tag; |
| Description: | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases. This protein is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, this protein does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and it is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternative splicing results in two transcript variants. An additional splice variant has been described but its biological validity has not been determined. |
| Applications: | This product is useful for Antibody Production and Protein Array |
| Tissue Specificity: | Expressed at low levels in several tissues including testis, ovary, and thymus. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.630kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | LVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSSRHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL |
| Sequence Similarities: | Belongs to the C5-methyltransferase family.Contains 1 ADD-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | DNMT3L DNA (cytosine-5-)-methyltransferase 3-like [ Homo sapiens ] |
| Gene ID NCBI: | 29947 |
| Official Symbol: | DNMT3L |
| Synonyms: | DNMT3L; DNA (cytosine-5-)-methyltransferase 3-like; DNA (cytosine-5)-methyltransferase 3-like; cytosine 5 methyltransferase 3 like protein; human cytosine 5 methyltransferase 3 like protein; MGC1090; |
| mRNA Refseq: | NM_013369 |
| Protein Refseq: | NP_037501 |
| MIM: | 606588 |
| UniProt ID: | Q9UJW3 |
| Chromosome Location: | 21q22.3 |
| Function: | enzyme activator activity; enzyme binding; metal ion binding; protein binding; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0008 | Vinorelbine Tartrate | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
| EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
| EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
| DNMT | DNMT1 | DNMT2 | DNMT3A |
| DNMT3B | DNMT3L | DNMT4 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
