| Cat.No.: | PE-0218 |
| Product Name: | Recombinant Human EZH2, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 558-707 of Human KMT6/EZH2 isoform 3 with an N-terminal His Tag, 150 amino aicds, approximately 24kDa. |
| Description: | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. |
| Tissue Specificity: | Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:reconstitution with 60 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | KNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNE FISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFV VDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFA KRAIQTGEELFFDYRYSQADALKYVGIEREMEIP |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family. EZ subfamily.Contains 1 SET domain. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ] |
| Gene ID NCBI: | 2146 |
| Official Symbol: | EZH2 |
| Synonyms: | EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; |
| mRNA Refseq: | NM_001203247 |
| Protein Refseq: | NP_001190176 |
| MIM: | 601573 |
| UniProt ID: | Q15910 |
| Chromosome Location: | 7q35-q36 |
| Function: | DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0006 | GSK343 | Inquiry |
| BSM-0059 | 3-Deazaneplanocin A | Inquiry |
| BSM-0060 | 3-Deazaneplanocin A hydrochloride | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0024 | Recombinant Human EZH1 293 Cell Lysate | Inquiry |
| EL-0025 | Recombinant Human EZH2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| ezh1 | EZH2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
