| Cat.No.: | PE-0159 |
| Product Name: | Recombinant Human SIRT3, His-tagged |
| Product Overview: | Recombinant fragment of Human SIRT3 with N terminal His tag; 303aa, 33.5kDa. |
| Description: | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. |
| Tissue Specificity: | Widely expressed. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 33.500kDa inclusive of tags |
| Purity: | >95% by SDS-PAGE |
| Species: | Human |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK |
| Sequence Similarities: | Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain. |
| Expression System: | E. coli |
| Protein Length: | 282 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SIRT3 sirtuin 3 [ Homo sapiens ] |
| Gene ID NCBI: | 23410 |
| Official Symbol: | SIRT3 |
| Synonyms: | SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3; |
| mRNA Refseq: | NM_001017524 |
| Protein Refseq: | NP_001017524 |
| MIM: | 604481 |
| UniProt ID: | Q9NTG7 |
| Chromosome Location: | 11p15.5 |
| Function: | NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; hydrolase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides; metal ion binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
