| Cat.No.: | PE-0151 |
| Product Name: | Recombinant Human SIRT2 protein, T7/His-tagged |
| Product Overview: | Recombinant human SIRT2 cDNA (389aa, isoform-2) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE. |
| Species: | Human |
| Formulation: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVG AGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVF FGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDF DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTE REKPQ |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SIRT2 sirtuin 2 [ Homo sapiens ] |
| Gene ID NCBI: | 22933 |
| Official Symbol: | SIRT2 |
| Synonyms: | SIRT2; sirtuin 2; NAD-dependent deacetylase sirtuin-2; sirtuin type 2; SIR2-like protein 2; SIR2; SIR2L; SIR2L2; FLJ35621; FLJ37491; |
| mRNA Refseq: | NM_030593 |
| Protein Refseq: | NP_085096 |
| MIM: | 604480 |
| UniProt ID: | Q8IXJ6 |
| Chromosome Location: | 19q13 |
| Function: | NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; histone acetyltransferase binding; histone deacetylase binding; hydrolase activity; metal ion binding; protein binding; protein deacetylase activity; transcription factor binding; tubulin deacetylase activity; ubiquitin binding; zinc ion binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
