Cat.No.: | PE-0057 |
Product Name: | Recombinant Human HDAC4, His-tagged |
Product Overview: | Recombinant fragment, corresponding to amino acids 556-1084 of Human HDAC4 with a N terminal His tag; MWt 85 kDa: |
Description: | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3. |
Tissue Specificity: | Ubiquitous. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Species: | Human |
Formulation: | Lyophilised:reconstitution with 125 μl aqua dest. |
Tag: | His |
Amino Acid Sequence: | VQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQAL LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSS PASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGS SSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEEL QTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRL PCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVAT GELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLL QQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRY DDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMG DAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPT PLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEK VMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVT AMASLSVGVKPAEKRPDEEPMEEEPPL |
Sequence Similarities: | Belongs to the histone deacetylase family. HD type 2 subfamily. |
Expression System: | E. coli |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | HDAC4 histone deacetylase 4 [ Homo sapiens ] |
Gene ID NCBI: | 9759 |
Official Symbol: | HDAC4 |
Synonyms: | HDAC4; histone deacetylase 4; HA6116; HD4; HDAC 4; HDAC A; HDACA; KIAA0288; |
mRNA Refseq: | NM_006037 |
Protein Refseq: | NP_006028 |
MIM: | 605314 |
UniProt ID: | P56524 |
Chromosome Location: | 2q37.3 |
Function: | NAD-dependent histone deacetylase activity (H3-K14 specific); NAD-dependent histone deacetylase activity (H3-K9 specific); NAD-dependent histone deacetylase activity (H4-K16 specific); activating transcription factor binding; histone deacetylase activity; |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0006 | Recombinant Human HDAC1 293 Cell Lysate | Inquiry |
EL-0007 | Recombinant Human HDAC2 293 Cell Lysate | Inquiry |
EL-0008 | Recombinant Human HDAC3 Cell Lysate | Inquiry |
EL-0009 | Recombinant Human HDAC4 Cell Lysate | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0007 | Tubacin | Inquiry |
Related Gene / Proteins | |||
HDAC | HDAC1 | HDAC10 | HDAC11 |
HDAC2 | HDAC3 | hdac4 | hdac5 |
HDAC6 | hdac7 | HDAC8 | hdac9 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools