| Cat.No.: | EAb-3482 |
| Product Name: | ZMIZ2 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ZMIZ2 |
| Immunogen Sequence: | MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQCLGQQAFAEGGANKGYVQQGVYSRGGYPGAPGFTTGYAGGPGGLGLPSHAARPST |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 115kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | U-87MG,Jurkat,HeLa,293T,mouse brain,rat brain |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q8NF64; NP_001287888; Gene ID 83637 |
| Alternative Name: | ZMIZ2; NET27; TRAFIP20; ZIMP7; hZIMP7; zinc finger MIZ-type containing 2 |
| Scientific Background: | ZMIZ2 and ZMIZ1 are members of a PIAS-like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor and enhances AR-mediated transcription. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0097 | Recombinant Human ZMYND11 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0224 | Human ZMYM3 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0225 | Human ZMYND8 Knockout Cell Line 8bp deletion | Inquiry |
| CL-0226 | Human ZMYND11 Knockout Cell Line 31bp deletion | Inquiry |
| CL-0476 | Human ZMYND11 Knockout Cell Line 31bp deletion | Inquiry |
| Related Gene / Proteins | |||
| Zmat2 | ZMAT4 | ZMIZ2 | ZMYM3 |
| ZMYND11 | ZMYND15 | ZMYND8 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
