Cat.No.: | EAb-3476 |
Product Name: | PHC1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 750-940 of human PHC1 |
Immunogen Sequence: | FPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRW |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 125kDa/135kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | A-549,Mouse kidney |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot P78364; NP_004417.2; Gene ID 1911 |
Alternative Name: | PHC1; EDR1; HPH1; MCPH11; RAE28; polyhomeotic homolog 1 |
Scientific Background: | This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. |
Product Types | ||
◆ Antibodies | ||
EAb-0056 | PHF8 Polyclonal Antibody | Inquiry |
EAb-0058 | PHC2 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0114 | DMOG | Inquiry |
◆ Cell Lines | ||
CL-0115 | Human PHF6 Knockout Cell Line 1bp deletion | Inquiry |
CL-0116 | Human PHIP Knockout Cell Line 2bp deletion | Inquiry |
Related Gene / Proteins | |||
PHB | PHC1 | PHC2 | PHD |
PHD1 | PHD2 | PHD3 | PHF1 |
PHF10 | PHF13 | PHF17 | PHF2 |
PHF20 | PHF20B | PHF21A | PHF21B |
PHF6 | PHF8 | PHIP | PHPT1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools