| Cat.No.: | EAb-3473 |
| Product Name: | ACTL6B Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ACTL6B |
| Immunogen Sequence: | MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMP |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 47-55kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HL-60,22Rv1,BT-474,HeLa,HepG2,Mouse brain,Mouse skeletal muscle |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O94805; NP_057272.1; Gene ID 51412 |
| Alternative Name: | ACTL6B; ACTL6; BAF53B; arpNalpha; actin like 6B |
| Scientific Background: | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. Alternative splicing results in multiple transcript variants. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0035 | Arecoline hydrobromide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0045 | Recombinant Human ACTL6A 293 Cell Lysate | Inquiry |
| EL-0046 | Recombinant Human ACTL6A 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0193 | Human ACRBP Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-0201 | BAF53B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| ACAT1 | ACRBP | ACTL6 | ACTR8 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
