| Cat.No.: | EAb-3462 |
| Product Name: | NAP1L1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NAP1L1 |
| Immunogen Sequence: | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEF |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 57kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HeLa,A375,LO2 |
| Species Reactivity: | Human, Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot P55209; NP_004528.1; Gene ID 4673 |
| Alternative Name: | NAP1L1; NAP1; NAP1L; NRP; nucleosome assembly protein 1-like 1 |
| Scientific Background: | This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0040 | FK-866 HCl | Inquiry |
| BSM-0201 | Remodelin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0051 | Recombinant Human NACC2 Cell Lysate | Inquiry |
| EL-0085 | Recombinant Human NAP1L2 293 Cell Lysate | Inquiry |
| EL-0158 | Recombinant Human NASP 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| NAA38 | NAA60 | NACC2 | Nampt |
| Nanog | Nanos3 | Nap1 | NAP1L1 |
| NAP1L2 | NAP1L4 | NARG1 | NASP |
| NAT10 | NAT14 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
