| Cat.No.: | EAb-3458 |
| Product Name: | RBBP7 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 |
| Immunogen Sequence: | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVE |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 48kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC; IF; ChIP |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; ChIP: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HT-29,MCF7,293T |
| Species Reactivity: | Human, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q16576; NP_002884.1; Gene ID 5931 |
| Alternative Name: | RBBP7; RbAp46; histone-binding protein RBBP7 |
| Scientific Background: | This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
