Cat.No.: | EAb-3450 |
Product Name: | CHD1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1501-1710 of human CHD1 |
Immunogen Sequence: | IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Species Reactivity: | Human |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O14646; NP_001261.2; Gene ID 1105 |
Alternative Name: | CHD1; chromodomain-helicase-DNA-binding protein 1 |
Scientific Background: | The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0147 | Recombinant Human CHAF1A 293 Cell Lysate | Inquiry |
EL-0167 | Recombinant Human CHAF1B 293 Cell Lysate | Inquiry |
EL-0211 | Recombinant Human CHD2 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0180 | Mouse Chd7 peptide | Inquiry |
◆ Antibodies | ||
EAb-0199 | CHRDL1 Monoclonal Antibody (3H1-F6-A10) | Inquiry |
Related Gene / Proteins | |||
CHAF1A | CHAF1B | CHD1 | CHD2 |
CHD3 | CHD4 | CHD5 | Chd7 |
CHD8 | CHD9 | CHEK2 | CHRAC1 |
CHRDL1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools