| Cat.No.: | EAb-3442 |
| Product Name: | NAP1L4 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-375 of human NAP1L4 |
| Immunogen Sequence: | MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q99733; NP_005960.1; Gene ID 4676 |
| Alternative Name: | NAP1L4; NAP1L4b; NAP2; NAP2L; hNAP2; nucleosome assembly protein 1-like 4 |
| Scientific Background: | This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0040 | FK-866 HCl | Inquiry |
| BSM-0201 | Remodelin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0051 | Recombinant Human NACC2 Cell Lysate | Inquiry |
| EL-0085 | Recombinant Human NAP1L2 293 Cell Lysate | Inquiry |
| EL-0158 | Recombinant Human NASP 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| NAA38 | NAA60 | NACC2 | Nampt |
| Nanog | Nanos3 | Nap1 | NAP1L1 |
| NAP1L2 | NAP1L4 | NARG1 | NASP |
| NAT10 | NAT14 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
