| Cat.No.: | EAb-3433 |
| Product Name: | HMGA1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 |
| Immunogen Sequence: | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 16kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:1000 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Rat kidney |
| Species Reactivity: | Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot P17096; NP_665908.1; Gene ID 3159 |
| Alternative Name: | HMGA1; HMG-R; HMGA1A; HMGIY; high mobility group AT-hook 1 |
| Scientific Background: | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
