| Cat.No.: | EAb-3415 |
| Product Name: | KAT6B Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human KAT6B |
| Immunogen Sequence: | DLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEV |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q8WYB5; NP_001243398.1; Gene ID 23522 |
| Alternative Name: | KAT6B; GTPTS; MORF; MOZ2; MYST4; ZC2HC6B; qkf; querkopf; lysine acetyltransferase 6B |
| Scientific Background: | The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0073 | Anacardic Acid | Inquiry |
| ◆ Antibodies | ||
| EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
| CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| Kaiso | KANSL2 | KAP1 | KAT13A |
| KAT13D | KAT2A | KAT2B | KAT4 |
| KAT5 | KAT6A | KAT6B | KAT7 |
| KAT8 | KAT9 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
