Cat.No.: | EAb-3400 |
Product Name: | HMGB1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1 |
Immunogen Sequence: | SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 25kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:100 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | MCF7,HL-60,SW480,Raji,mouse spleen,mouse lung |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot P09429; NP_002119.1; Gene ID 3146 |
Alternative Name: | HMGB1; HMG-1; HMG1; HMG3; SBP-1; high mobility group box 1 |
Scientific Background: | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. |
Product Types | ||
◆ Antibodies | ||
EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
HMG-1 | HMG2L1 | HMG4 | HMGA1 |
HMGA2 | HMGB1 | HMGB2 | HMGB3 |
HMGB4 | HMGN1 | HMGN2 | HMGN3 |
HMGN5 | HMT1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools