| Cat.No.: | EAb-3357 |
| Product Name: | PARP1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PARP1 |
| Immunogen Sequence: | QLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKD |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 120kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Jurkat,293T,BT-474,Mouse thymus |
| Species Reactivity: | Human, Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot P09874; NP_001609.2; Gene ID 142 |
| Alternative Name: | PARP1; ADPRT; ADPRT 1; ADPRT1; ARTD1; PARP; PARP-1; PPOL; pADPRT-1; poly(ADP-ribose) polymerase 1 |
| Scientific Background: | This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0059 | PARP Monoclonal Antibody | Inquiry |
| EAb-0061 | PARP Polyclonal Antibody | Inquiry |
| EAb-0062 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0063 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0064 | Paf1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| PABPC1L2A | PABPC5 | PABPN1 | PAD |
| PAD1 | PAD2 | PAD3 | PAD4 |
| PADI1 | PADI2 | PADI3 | PADI4 |
| PADI6 | PAF1 | PAN2 | PAPD1 |
| PAPD4 | PAPD5 | PAPD7 | PAPOLA More > |
| PAPOLB | PARD6A | PARG | PARK2 |
| PARK7 | PARP | PARP1 | PARP10 |
| PARP11 | PARP12 | PARP14 | PARP15 |
| PARP16 | PARP2 | PARP3 | PARP4 |
| PARP6 | PARP7 | PARP8 | PARP9 |
| PAX5 | PAX6 | PAX7 | PAX9 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
