Cat.No.: | EAb-3350 |
Product Name: | SIRT1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 448-747 of human SIRT1 |
Immunogen Sequence: | VALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 140kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC; IF; IP |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; IP: 1:50 - 1:100 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | 293T,HeLa,Jurkat |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q96EB6; NP_036370.2; Gene ID 23411 |
Alternative Name: | SIRT1; SIR2; SIR2L1; SIR2alpha; sirtuin 1 |
Scientific Background: | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
Related Gene / Proteins | |||
Siah2 | SIK1 | SIMC1 | SIN3A |
SIN3B | SIP1 | Sir2p | SIRT |
SIRT1 | SIRT2 | SIRT3 | SIRT4 |
SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools