| Cat.No.: | EAb-3304 |
| Product Name: | MYST1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MYST1 |
| Immunogen Sequence: | MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPED |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 58kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | OVCAR3,NIH/3T3 |
| Species Reactivity: | Human, Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q9H7Z6; NP_892003.2; Gene ID 84148 |
| Alternative Name: | KAT8; MOF; MYST1; ZC2HC8; hMOF; lysine acetyltransferase 8 |
| Scientific Background: | This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0184 | MYCBP Polyclonal Antibody | Inquiry |
| EAb-0204 | c-Myb Polyclonal Antibody | Inquiry |
| EAb-0380 | MYSM1 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0344 | Human MYSM1 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| MYB | Myc | MYCBP | Myf-5 |
| Myocilin | MyoD | MYSM1 | MYST1 |
| MYST3 | Myt1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
