| Cat.No.: | EAb-3293 |
| Product Name: | KAT2B Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 583-832 of human KAT2B |
| Immunogen Sequence: | KGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 93kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Mouse heart,Mouse brain,Rat heart |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q92831; NP_003875.3; Gene ID 8850 |
| Alternative Name: | KAT2B; CAF; P/CAF; PCAF; lysine acetyltransferase 2B |
| Scientific Background: | CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0073 | Anacardic Acid | Inquiry |
| ◆ Antibodies | ||
| EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
| CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| Kaiso | KANSL2 | KAP1 | KAT13A |
| KAT13D | KAT2A | KAT2B | KAT4 |
| KAT5 | KAT6A | KAT6B | KAT7 |
| KAT8 | KAT9 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
