| Cat.No.: | EAb-3280 |
| Product Name: | RNF40 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RNF40 |
| Immunogen Sequence: | MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLAERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVEDLQWDIEKLRKREQKLNKHL |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 140kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC; IF; ChIP |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; ChIP: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | MCF7,HepG2,U-937 |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O75150; NP_055586.1; Gene ID 9810 |
| Alternative Name: | RNF40; BRE1B; RBP95; STARING; ring finger protein 40 |
| Scientific Background: | The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0123 | Human RNF167 Knockout Cell Line | Inquiry |
| CL-0124 | Human RNF2 Knockout Cell Line 553bp insertion | Inquiry |
| CL-0125 | Human RNF25 Knockout Cell Line | Inquiry |
| CL-0126 | Human RNF26 Knockout Cell Line | Inquiry |
| CL-0127 | Human RNF24 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| RNA Helicase A | RNA pol II | RNF103 | RNF11 |
| RNF128 | RNF133 | RNF138 | RNF141 |
| RNF167 | RNF168 | RNF181 | RNF182 |
| RNF183 | RNF2 | RNF20 | RNF207 |
| RNF208 | RNF212 | RNF213 | RNF214 More > |
| RNF215 | RNF217 | RNF219 | RNF220 |
| RNF222 | RNF223 | RNF224 | RNF24 |
| RNF25 | RNF26 | RNF31 | RNF40 |
| RNF7 | RNF8 | RNP | RNPC3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
