| Cat.No.: | EAb-3252 |
| Product Name: | HJURP Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect HJURP |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human HJURP aa 47-177. |
| Immunogen Sequence: | TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQA AAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNEL RRKYLTQVDILLQGAEYFECAGNRAGRDVRV |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | ICC/IF, IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q8NCD3 |
| Alternative Name: | 14-3-3-associated AKT substrate antibody/FAKTS antibody/fetal liver expressing gene 1 antibody |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0834 | HJURP Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-0835 | HJURP Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-0836 | HJURP Polyclonal Antibody, Biotin Conjugated | Inquiry |
| EAb-0841 | HJURP Polyclonal Antibody | Inquiry |
| EAb-3130 | HJURP Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HJURP | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
