Cat.No.: | EAb-3252 |
Product Name: | HJURP Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect HJURP |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human HJURP aa 47-177. |
Immunogen Sequence: | TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQA AAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNEL RRKYLTQVDILLQGAEYFECAGNRAGRDVRV |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS |
Applications: | ICC/IF, IHC-P |
Species Reactivity: | Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q8NCD3 |
Alternative Name: | 14-3-3-associated AKT substrate antibody/FAKTS antibody/fetal liver expressing gene 1 antibody |
Product Types | ||
◆ Antibodies | ||
EAb-0834 | HJURP Polyclonal Antibody, HRP Conjugated | Inquiry |
EAb-0835 | HJURP Polyclonal Antibody, FITC Conjugated | Inquiry |
EAb-0836 | HJURP Polyclonal Antibody, Biotin Conjugated | Inquiry |
EAb-0841 | HJURP Polyclonal Antibody | Inquiry |
EAb-3130 | HJURP Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
HJURP |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools